DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and CG7763

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:269 Identity:75/269 - (27%)
Similarity:124/269 - (46%) Gaps:64/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VCLLS---------DPPNQCSEYCVSALQPVIDHLSKEQQDWGACEVKLNGSVAKL---DKIEDQ 83
            :||.|         :..:||:.||...|.|.|..:...|:...|||..:  ::|::   |:..|.
  Fly    12 LCLSSSYSAACEGVESDSQCAAYCYGVLNPCIASMGNLQRRVEACEAAV--AIARIALNDRRLDN 74

  Fly    84 L-TATQIQIEAQQAFLVNNISKAIKTEDLEQKLKDIEGNQTALSNQLKDGQKRTENQLTAIQKTL 147
            . |:|.:|:|.|      |.|:.:.|            :.||:      |:|..||::       
  Fly    75 FGTSTNLQLENQ------NTSQQLLT------------HGTAM------GRKLEENEI------- 108

  Fly   148 SDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKAN- 211
                       :||:||:|:|||...::||..|..:|.:||||||:.|:.||.:....|||..| 
  Fly   109 -----------FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNR 162

  Fly   212 YWLGVNDLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCAYV--FGHENIMIVLSCTTDVMH 274
            ||:.|.:...:.||:|:..|.:|.:..|...||..:.   .|..:  |..:..|...||..: ::
  Fly   163 YWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDG---ECVDIRTFNGKTTMNDNSCFAN-LY 223

  Fly   275 FICQSDSDV 283
            |||:...::
  Fly   224 FICEKSIEI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 40/116 (34%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448813
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.