DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Lectin-galC1

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster


Alignment Length:167 Identity:38/167 - (22%)
Similarity:74/167 - (44%) Gaps:30/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGH 190
            |.|:.:|     |...|:.|.          :.:.:|...|::.... .:||..|.::|.|:...
  Fly    25 SIQVNEG-----NTFGALVKA----------EPFTKINDGYYFFGTE-SLNWYEAYEKCRELNSE 73

  Fly   191 LAAFQNAEEYNAIVGQL----NKANYWLGVNDLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQ 251
            |..|:..:|::|:...|    ::..||...|||||.|......:.:|.:..:|.:|:|......:
  Fly    74 LVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKE 138

  Fly   252 HC---AYVFGHENIMIVLS---CTTD---VMHFICQS 279
            ||   .|:: .::....|:   |:.|   :..:||::
  Fly   139 HCIHLGYIY-KDSRKFELNDRPCSQDPNSLFKYICEA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 30/126 (24%)
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 29/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.