DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and CD209

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:264 Identity:60/264 - (22%)
Similarity:110/264 - (41%) Gaps:55/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QEGRRYVCLLSDPPNQCSEYCVSALQPVIDHLSKEQQDWGACEVKLNGSVAKLDKIEDQLTATQI 89
            ||..|....:.:.|.:      |.||.:...|:     |....|......:|:.:|..:||    
Human   125 QELTRLKAAVGELPEK------SKLQEIYQELT-----WLKAAVGELPEKSKMQEIYQELT---- 174

  Fly    90 QIEAQQAFLVNNISKAIKTEDLEQKLKDIEGNQTALSNQLKDGQKRTE--NQLTAIQKTLSDIER 152
            :::|    .|..:.:..|.:::.|:|..::    |...:|.:..|:.|  .:||.::..:.::..
Human   175 RLKA----AVGELPEKSKQQEIYQELTRLK----AAVGELPEKSKQQEIYQELTRLKAAVGELPE 231

  Fly   153 KLVLQR-YQQI----------------------GSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAF 194
            |...|. ||::                      |:.||.  .|.|.||..:...|.|:|..|...
Human   232 KSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFM--SNSQRNWHDSITACKEVGAQLVVI 294

  Fly   195 QNAEEYNAIVGQLNKAN--YWLGVNDLAKQGEFISLASGKRATYFK--WRKNEPKYNNPTQHCAY 255
            ::|||.|.:..|.:::|  .|:|::||.::|.:..:........||  |.:.||. |...:.||.
Human   295 KSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPN-NVGEEDCAE 358

  Fly   256 VFGH 259
            ..|:
Human   359 FSGN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 30/100 (30%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59
PilO 38..>184 CDD:294757 16/77 (21%)
neck domain 60..249 29/146 (20%)
CLECT_DC-SIGN_like 256..379 CDD:153060 31/110 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.