DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Colec10

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:162 Identity:40/162 - (24%)
Similarity:73/162 - (45%) Gaps:38/162 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLA 192
            :||...|..:|.:..|::|    |.|            ::||... :.|:|.:...|...||.||
  Rat   137 RLKTSMKFIKNVIAGIRET----EEK------------FYYIVQE-EKNYRESLTHCRIRGGMLA 184

  Fly   193 AFQNAEEYNAIVGQLNKANY---WLGVNDLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCA 254
            ..::......|...:.|:.:   ::|||||.|:|:::...:.....|..|::.||  ::|     
  Rat   185 MPKDEVVNTLIADYVAKSGFFRVFIGVNDLEKEGQYVFTDNTPLQNYSNWKEGEP--SDP----- 242

  Fly   255 YVFGHENIMIVLS--------CTTDVMHFICQ 278
              :|||:.:.:||        |.. .|:|:|:
  Rat   243 --YGHEDCVEMLSSGRWNDTECHL-TMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790 8/36 (22%)
CLECT 164..278 CDD:153057 31/124 (25%)
Colec10NP_001124013.1 gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 33/138 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.