DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Cd209a

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001099374.1 Gene:Cd209a / 288375 RGDID:1308239 Length:240 Species:Rattus norvegicus


Alignment Length:101 Identity:28/101 - (27%)
Similarity:44/101 - (43%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANY-WLGVNDLAKQ---- 222
            |:.||:  ...|.:|..:...|..:|..|...::.||.|.:.....|..| |:|:.|:.|:    
  Rat   119 GNCYFF--SVAQKSWNDSATACHNVGAQLVVIKSEEEQNFLQKTSKKRGYTWMGLIDINKESTWH 181

  Fly   223 ---GEFISLASGKRATYFK-WRKNEPKYNNPTQHCA 254
               |..::|      |:.| |.|.||. |...:.||
  Rat   182 WVDGSPLTL------TFMKYWNKGEPN-NVGDKDCA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 27/100 (27%)
Cd209aNP_001099374.1 CLECT_DC-SIGN_like 110..232 CDD:153060 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.