DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and CLEC4E

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_055173.1 Gene:CLEC4E / 26253 HGNCID:14555 Length:219 Species:Homo sapiens


Alignment Length:96 Identity:22/96 - (22%)
Similarity:41/96 - (42%) Gaps:10/96 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 SRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNK-ANYWLGVNDLAKQGEFIS 227
            |.||:....  ::|..:.:.|..||.||....:.||...:..:..| ..:::|::|...:|:: .
Human    90 SCYFFSTDT--ISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQW-Q 151

  Fly   228 LASG----KRATYFKWRKNEPKYNNPTQHCA 254
            ...|    |..::  |...||......:.||
Human   152 WVDGTPLTKSLSF--WDVGEPNNIATLEDCA 180

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity