DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Mbl1

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:151 Identity:37/151 - (24%)
Similarity:71/151 - (47%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 GNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKL--------------VLQRYQQIGSRYFYIE 170
            |:..|..:|...|||.......||:..|:::|.::              .....::.|.::|...
  Rat    68 GSVGAPGSQGPKGQKGDRGDSRAIEVKLANMEAEINTLKSKLELTNKLHAFSMGKKSGKKFFVTN 132

  Fly   171 HNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRAT 235
            |. ::.:...:..|.|:.|.:|..:|||| |..:.::.|.:.:||:.|...:|:|:.:..| |.|
  Rat   133 HE-RMPFSKVKALCSELRGTVAIPRNAEE-NKAIQEVAKTSAFLGITDEVTEGQFMYVTGG-RLT 194

  Fly   236 YFKWRKNEPKYNNPTQHCAYV 256
            |..|:|:||..:...:.|..:
  Rat   195 YSNWKKDEPNDHGSGEDCVTI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 26/93 (28%)
Mbl1NP_036731.2 Collagen 36..>88 CDD:189968 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87 6/18 (33%)
CLECT_collectin_like 126..236 CDD:153061 26/93 (28%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11575
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto98669
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.