Sequence 1: | NP_609116.1 | Gene: | CG15818 / 34019 | FlyBaseID: | FBgn0031910 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001207429.1 | Gene: | FCER2 / 2208 | HGNCID: | 3612 | Length: | 321 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 44/206 - (21%) |
---|---|---|---|
Similarity: | 81/206 - (39%) | Gaps: | 43/206 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 DKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDLEQKLKDIEGNQTALS----------NQLKDG 132
Fly 133 QKRTENQLTAIQKTLS---------------DIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQ 182
Fly 183 RCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATYFKWRKNEPKYN 247
Fly 248 NPTQHCAYVFG 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15818 | NP_609116.1 | CLECT | 164..278 | CDD:153057 | 24/95 (25%) |
FCER2 | NP_001207429.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 66..85 | 1/7 (14%) | |
Repetitive region | 69..89 | 3/11 (27%) | |||
RILP-like | <77..153 | CDD:304877 | 17/79 (22%) | ||
Repetitive region | 90..110 | 5/22 (23%) | |||
Repetitive region | 111..131 | 4/20 (20%) | |||
CLECT | 163..282 | CDD:214480 | 26/116 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 290..321 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |