DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Reg3a

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_035389.1 Gene:Reg3a / 19694 MGIID:109408 Length:175 Species:Mus musculus


Alignment Length:88 Identity:20/88 - (22%)
Similarity:36/88 - (40%) Gaps:11/88 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 NWRTAEQRCIEM-GGHLAAFQNAEEYNAIVGQLNKA--NY---WLGVND--LAKQ--GEFISLAS 230
            :|..|:..|.:. .|||.:..:..|.:.:...:|..  ||   |:|::|  :.:|  |.....::
Mouse    60 SWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSN 124

  Fly   231 GKRATYFKWRKNEPKYNNPTQHC 253
            .....|..| ..:|.......||
Mouse   125 SDVLNYLNW-DGDPSSTVNRGHC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790
CLECT 164..278 CDD:153057 20/88 (23%)
Reg3aNP_035389.1 CLECT 40..173 CDD:470576 20/88 (23%)
Sufficient to activate EXTL3. /evidence=ECO:0000250|UniProtKB:Q06141 103..118 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.