DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Reg2

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_033069.1 Gene:Reg2 / 19693 MGIID:97896 Length:173 Species:Mus musculus


Alignment Length:116 Identity:27/116 - (23%)
Similarity:42/116 - (36%) Gaps:38/116 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 YFYIEHNLQVNWRTAEQRCIEM-GGHLAAFQNAEEYNAIVGQLNK-----ANYWLGVND------ 218
            |:.||..|  .|..|:..|..| .|||.:..:..|.|.:...:.:     :|.|.|::|      
Mouse    55 YYLIEDRL--TWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRR 117

  Fly   219 --------------------LAKQGEFISLASGKRATYFKWRKN--EPKYN 247
                                .|.:|..:||.|  ...|.||:..  |.:|:
Mouse   118 WHWSSGSLFLFKSWATGAPSTANRGYCVSLTS--NTAYKKWKDENCEAQYS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790
CLECT 164..278 CDD:153057 27/116 (23%)
Reg2NP_033069.1 CLECT 43..171 CDD:470576 27/116 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.