DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Reg1

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_033068.1 Gene:Reg1 / 19692 MGIID:97895 Length:165 Species:Mus musculus


Alignment Length:89 Identity:23/89 - (25%)
Similarity:37/89 - (41%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 YFYIEHNLQVNWRTAEQRCIEM-GGHLAAFQNAEEYNAIVGQLNK-----ANYWLGVNDLAKQGE 224
            |::.|..|  .|..|:..|..| .|:|.:..:..|.|.:...:.:     ||.|.|::| .|:..
Mouse    47 YYFTEDRL--TWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHD-PKRNR 108

  Fly   225 FISLASGKRATYFKWRKNEPKYNN 248
            ....:||....|..|....|..:|
Mouse   109 RWHWSSGSLFLYKSWATGSPNSSN 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790
CLECT 164..278 CDD:153057 23/89 (26%)
Reg1NP_033068.1 CLECT 35..163 CDD:470576 23/89 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.