DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and clec-266

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001024428.1 Gene:clec-266 / 180932 WormBaseID:WBGene00016088 Length:248 Species:Caenorhabditis elegans


Alignment Length:91 Identity:21/91 - (23%)
Similarity:41/91 - (45%) Gaps:22/91 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 FYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANY-WLGVNDLAKQGEFISLAS 230
            ::||.:.| ::..||:||.|....|....:.:|::|:.....:..| |:|:              
 Worm   106 YWIEQHKQ-SFAEAEKRCYEKNATLFVVNSQDEWDAVREHFPQTGYTWIGL-------------- 155

  Fly   231 GKRATYFKWRKNEPKYN-----NPTQ 251
             .|.|:|:..::.|.:.     |||:
 Worm   156 -VRFTHFEKSQDAPIWQTEGAVNPTR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790
CLECT 164..278 CDD:153057 21/91 (23%)
clec-266NP_001024428.1 CLECT 94..231 CDD:214480 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.