DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and clec-178

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_500843.1 Gene:clec-178 / 177344 WormBaseID:WBGene00020585 Length:178 Species:Caenorhabditis elegans


Alignment Length:147 Identity:44/147 - (29%)
Similarity:65/147 - (44%) Gaps:15/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NQTALSNQLKDGQKRTENQLTAIQKTLS-DIE-RKLVLQRYQQIG----SRYFYIEHNLQVNWRT 179
            |...:.:.||     :..|..|.|:.:: |:. |.|.:...||.|    ..::|......|.|..
 Worm    14 NTVVIPSPLK-----SSYQSIAGQRAINLDVNVRLLTVLALQQSGWQLYEDHWYKMFETDVMWIP 73

  Fly   180 AEQRCIEMGGHLAAFQNAEEYNAIVGQLNKA-NYWLGVNDLAKQGEFISLASGKRATYFKWRKNE 243
            ||..|..|||||.:.::..| |..|.:|.|. |.|:|:|.|.........:.|..|.|..|..::
 Worm    74 AENVCRSMGGHLVSIKDESE-NLFVHKLRKKNNIWIGLNKLNDTFHVYKWSDGSEADYLNWASSQ 137

  Fly   244 PKYNNPTQHCAYVFGHE 260
            |  |.|...|||:..|:
 Worm   138 P--NEPDVDCAYMAFHQ 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 32/98 (33%)
clec-178NP_500843.1 CLECT 52..174 CDD:214480 33/104 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4091
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.