DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and clec-85

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001370868.1 Gene:clec-85 / 177068 WormBaseID:WBGene00021872 Length:280 Species:Caenorhabditis elegans


Alignment Length:91 Identity:19/91 - (20%)
Similarity:34/91 - (37%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 IGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVG----QLNKANYWLGVNDLAKQ 222
            ||...:.|...| :.:..|:..|.....:||....:.:.|.:..    |.....:|:|::..:..
 Worm    26 IGDLCYSISAQL-LKFTDAQSACYSQNQNLAVIHTSLQANFLASIVRTQTGSQKFWIGLSRASSS 89

  Fly   223 GEFISLASGKRATYFKWRKNEPKYNN 248
            ..| ....|....:..:..|.||.||
 Worm    90 SRF-QWDDGTTMYWSNFDMNFPKDNN 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790 2/2 (100%)
CLECT 164..278 CDD:153057 17/89 (19%)
clec-85NP_001370868.1 CLECT 21..138 CDD:214480 19/91 (21%)
PRK14959 <181..>280 CDD:184923
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.