DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and clec-83

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_500260.3 Gene:clec-83 / 177065 WormBaseID:WBGene00021879 Length:237 Species:Caenorhabditis elegans


Alignment Length:87 Identity:17/87 - (19%)
Similarity:36/87 - (41%) Gaps:7/87 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 YIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQL------NKANYWLGVNDLAKQGEFI 226
            |:..|.|::::.|...|..:...||......:.|.:...:      :.:.:|:|::..:....| 
 Worm    34 YVVVNQQLSYQDAVGYCHGISTSLAVVHTTLQANFLASTIRTKTGTSDSLFWIGLSRASSSSRF- 97

  Fly   227 SLASGKRATYFKWRKNEPKYNN 248
            :...|....:..:..|.||.||
 Worm    98 TWDDGSVMYWSNFDLNFPKDNN 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790
CLECT 164..278 CDD:153057 17/87 (20%)
clec-83NP_500260.3 CLECT 22..143 CDD:214480 17/87 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.