DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Cd209e

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_570975.1 Gene:Cd209e / 170780 MGIID:2157948 Length:208 Species:Mus musculus


Alignment Length:205 Identity:50/205 - (24%)
Similarity:83/205 - (40%) Gaps:58/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GSVAKLDKIEDQLTATQIQIEAQQAFL----------VNNISKAIKTEDL-------EQKLKDIE 119
            ||:..|||       ..|.:..|..||          :..:||...:|::       |:..||: 
Mouse     7 GSLGFLDK-------GHIPLVLQLLFLILFTGLLVAIIIQVSKMPSSEEIQWEHTKQEKMYKDL- 63

  Fly   120 GNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQI---GSRYFYIEHNLQVNWRTAE 181
                   :|||                 |:::|...|..:...   |:.||:.:.  |.:|..:.
Mouse    64 -------SQLK-----------------SEVDRLCRLCPWDWTFFNGNCYFFSKS--QRDWHDSM 102

  Fly   182 QRCIEMGGHLAAFQNAEEYNAIVGQLNKANY-WLGVNDLAKQGEFISLASGKRATYFK--WRKNE 243
            ..|.|||..|...::.||.:.:.....|.:| |:|::||.|:||:..|.....:..|:  |:|.:
Mouse   103 TACKEMGAQLVIIKSHEEQSFLQQTSKKNSYTWMGLSDLNKEGEWYWLDGSPLSDSFEKYWKKGQ 167

  Fly   244 PKYNNPTQHC 253
            |. |...|.|
Mouse   168 PN-NVGGQDC 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 28/93 (30%)
Cd209eNP_570975.1 CLECT_DC-SIGN_like 77..199 CDD:153060 29/103 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.