DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Cd209d

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_570974.1 Gene:Cd209d / 170779 MGIID:2157947 Length:237 Species:Mus musculus


Alignment Length:164 Identity:37/164 - (22%)
Similarity:66/164 - (40%) Gaps:44/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 SDIERKLVLQRYQQI-----------------------GSRYFYIEHNLQVNWRTAEQRCIEMGG 189
            |:::.|:    ||::                       ||.||:.:.  |.||..:...|.|:|.
Mouse    81 SEVQNKI----YQELMQLKAEVHDGLCQPCARDWTFFNGSCYFFSKS--QRNWHNSTTACQELGA 139

  Fly   190 HLAAFQNAEEYNAIVGQLNKAN--YWLGVNDLAKQGEFISLASGKRATYFK--WRKNEPKYNNPT 250
            .|...:..|| ...:.|.:||.  .|:|::|:..:..:..:.....:..|.  |.:.||. |...
Mouse   140 QLVIIETDEE-QTFLQQTSKARGPTWMGLSDMHNEATWHWVDGSPLSPSFTRYWNRGEPN-NVGD 202

  Fly   251 QHCAYVFG---HENIMIVLSCTTDVMHFICQSDS 281
            :.||...|   ::     ||| ..::.:||:..|
Mouse   203 EDCAEFSGDGWND-----LSC-DKLLFWICKKVS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 30/120 (25%)
Cd209dNP_570974.1 CLECT_DC-SIGN_like 106..228 CDD:153060 32/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.