DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and CLEC4C

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001358319.1 Gene:CLEC4C / 170482 HGNCID:13258 Length:213 Species:Homo sapiens


Alignment Length:147 Identity:31/147 - (21%)
Similarity:53/147 - (36%) Gaps:55/147 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IERKLVLQRYQQ--------------------------IGSRYFYIEHNLQVNWRTAEQRCIEMG 188
            ::|...|:.|||                          ..|..::|...:| :|..:::.|..||
Human    52 VKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQ-SWTKSQKNCSVMG 115

  Fly   189 GHLAAFQNAEEYNAIVGQLNK-ANYWLGVNDLAKQGEFISLASGKR-------------ATYFKW 239
            ..|......||.:.|:..|.: ::|:||::|          ..|:|             .|:  |
Human   116 ADLVVINTREEQDFIIQNLKRNSSYFLGLSD----------PGGRRHWQWVDQTPYNENVTF--W 168

  Fly   240 RKNEPKYNNPTQHCAYV 256
            ...||  ||..:.||.:
Human   169 HSGEP--NNLDERCAII 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 26/107 (24%)
CLEC4CNP_001358319.1 CLECT_DC-SIGN_like 83..208 CDD:153060 26/116 (22%)
Carbohydrate binding. /evidence=ECO:0000269|PubMed:25995448, ECO:0007744|PDB:4ZET 184..186 31/147 (21%)
Carbohydrate binding. /evidence=ECO:0000269|PubMed:25995448, ECO:0007744|PDB:4ZET 194..195
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.