DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and CLEC4F

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_011530937.1 Gene:CLEC4F / 165530 HGNCID:25357 Length:699 Species:Homo sapiens


Alignment Length:227 Identity:56/227 - (24%)
Similarity:92/227 - (40%) Gaps:79/227 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KLNGSVAKLDKIEDQLTATQIQIEAQQAFLVN--------------NISKAIKTEDLEQKLK--- 116
            |.||   :||:     |.||||:...:...||              |.|:.|:|  |:|.:|   
Human   457 KANG---RLDQ-----TDTQIQVFKSEMENVNTLNAQIQVLNGHMKNASREIQT--LKQGMKNAS 511

  Fly   117 -------------------------DIEGNQTALSNQLKDGQKR---------TENQLTAIQKTL 147
                                     |:| |..||:.:::..|.|         ::.||   |:|.
Human   512 ALTSQTQMLDSNLQKASAEIQRLRGDLE-NTKALTMEIQQEQSRLKTLHVVITSQEQL---QRTQ 572

  Fly   148 SDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANY 212
            |.: .::|||.::..|...:|.. :::.:|..|||.|:..|.|||:..:.||...:|...:|..|
Human   573 SQL-LQMVLQGWKFNGGSLYYFS-SVKKSWHEAEQFCVSQGAHLASVASKEEQAFLVEFTSKVYY 635

  Fly   213 WLGVNDLAKQGEFISLASGKRATYFKWRKNEP 244
            |:|:.|...:|.            ::|....|
Human   636 WIGLTDRGTEGS------------WRWTDGTP 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 21/81 (26%)
CLEC4FXP_011530937.1 Lebercilin 374..556 CDD:292252 26/109 (24%)
CLECT_DC-SIGN_like 581..>657 CDD:153060 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.