Sequence 1: | NP_609116.1 | Gene: | CG15818 / 34019 | FlyBaseID: | FBgn0031910 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011530937.1 | Gene: | CLEC4F / 165530 | HGNCID: | 25357 | Length: | 699 | Species: | Homo sapiens |
Alignment Length: | 227 | Identity: | 56/227 - (24%) |
---|---|---|---|
Similarity: | 92/227 - (40%) | Gaps: | 79/227 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 KLNGSVAKLDKIEDQLTATQIQIEAQQAFLVN--------------NISKAIKTEDLEQKLK--- 116
Fly 117 -------------------------DIEGNQTALSNQLKDGQKR---------TENQLTAIQKTL 147
Fly 148 SDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANY 212
Fly 213 WLGVNDLAKQGEFISLASGKRATYFKWRKNEP 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15818 | NP_609116.1 | CLECT | 164..278 | CDD:153057 | 21/81 (26%) |
CLEC4F | XP_011530937.1 | Lebercilin | 374..556 | CDD:292252 | 26/109 (24%) |
CLECT_DC-SIGN_like | 581..>657 | CDD:153060 | 23/88 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |