DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and CG43055

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:129 Identity:38/129 - (29%)
Similarity:61/129 - (47%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 YQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEE----YNAIVGQLNKANYWLGVNDL 219
            :.:||..|::||:.|..||..|.:.|.:|...|.||::.:|    |:.:|.......||....||
  Fly    42 FVKIGDSYYFIENKLDRNWYDAFEACRQMNADLVAFEDRKEQKLIYHYLVDNEMDTTYWTAGTDL 106

  Fly   220 AKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCA-YVFGHENIMIVLS---CTTDVMHFICQS 279
            |:|..|:..::|:......|..|||......:||. |...|....:.|:   ||... .:||::
  Fly   107 AEQDSFVWFSNGQPVASDLWCNNEPNNAKNEEHCVEYKPLHPEAKMGLNDRVCTFKT-GYICRA 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 35/121 (29%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 34/118 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.