DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Asgr2

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001300854.1 Gene:Asgr2 / 11890 MGIID:88082 Length:301 Species:Mus musculus


Alignment Length:270 Identity:49/270 - (18%)
Similarity:97/270 - (35%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VCLLSDPPNQCSEYCVSALQPVIDHLSKEQQDWGACEVKLNGS--------VAKLDKIEDQLTAT 87
            :|::|....|..|...:..:...:..|....::||.:. |.||        :|:|::.:.||.|.
Mouse    74 ICVVSSQSIQLQEEFRTLKETFSNFSSSTLMEFGALDT-LGGSTNAILTSWLAQLEEKQQQLKAD 137

  Fly    88 QIQIEAQQAFLVNNISKAIKTEDLEQKLKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIER 152
            ...:    .|.:.:....::|...:.......|.:....|.::.|                    
Mouse   138 HSTL----LFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFG-------------------- 178

  Fly   153 KLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVN 217
                      ||.|::....|  .|..|:|.|.....||....:.||.:.:|...::.:.|:|:.
Mouse   179 ----------GSCYWFSRDGL--TWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLT 231

  Fly   218 DLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQH-------CAYVF--GHENIMIVLSCTTDVM 273
            |.....:::. .:..|:.|..|...:|  :|...|       ||.:.  ||.|.    :....|.
Mouse   232 DRDGSWKWVD-GTDYRSNYRNWAFTQP--DNWQGHEQGGGEDCAEILSDGHWND----NFCQQVN 289

  Fly   274 HFICQSDSDV 283
            .::|:...::
Mouse   290 RWVCEKRRNI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 27/122 (22%)
Asgr2NP_001300854.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Lectin_N 29..162 CDD:281887 17/92 (18%)
CLECT_DC-SIGN_like 170..295 CDD:153060 31/163 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.