DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Clec4f

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_446205.1 Gene:Clec4f / 114598 RGDID:621062 Length:550 Species:Rattus norvegicus


Alignment Length:292 Identity:62/292 - (21%)
Similarity:118/292 - (40%) Gaps:61/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VSA-LQPVIDHLSKEQQDWGACEVKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTE 109
            :|| :|.:.|.:.:..::..:.:..|....|::......|..|..||:..:|.|.:..|...:.|
  Rat   256 ISAEIQAMRDGMQRAGEEMTSLKKDLETLTAQIQNANGHLEQTDTQIQGLKAQLKSTSSLNSQIE 320

  Fly   110 DLEQKLKD-----------------IEGN-QTALSN---------QLKDGQKRTENQLTAIQKTL 147
            .:..||||                 ::.| |...||         .||.|.:.|:.....||...
  Rat   321 VVNGKLKDSSRELQTLRRDLSDVSALKSNVQMLQSNLQKAKAEVQSLKTGLEATKTLAAKIQGQQ 385

  Fly   148 SDIER-------------------KLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAA 193
            ||:|.                   :|::|.::....:::|...: :.:|..||..|:..|.|||:
  Rat   386 SDLEALQKAVAAHTQGQKTQNQVLQLIMQDWKYFNGKFYYFSRD-KKSWHEAENFCVSQGAHLAS 449

  Fly   194 FQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATYFK----WRKNEPKY----NNPT 250
            ..:.||...:|...|..::|:|:.|...:|.: ....|....|.:    |||.:|..    |...
  Rat   450 VTSQEEQAFLVQITNAVDHWIGLTDQGTEGNW-RWVDGTPFDYVQSRRFWRKGQPDNWRHGNGER 513

  Fly   251 QHCAYVFGHENIMIVLSCTTDVMHFICQSDSD 282
            :.|.::   :.:...::|.| ..:::|:..:|
  Rat   514 EDCVHL---QRMWNDMACGT-AYNWVCKKSTD 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 27/121 (22%)
Clec4fNP_446205.1 SMC_prok_B <100..390 CDD:274008 30/133 (23%)
CLECT_DC-SIGN_like 414..538 CDD:153060 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.