DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and asgrl2

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_005170656.1 Gene:asgrl2 / 101882127 ZFINID:ZDB-GENE-080917-52 Length:299 Species:Danio rerio


Alignment Length:243 Identity:53/243 - (21%)
Similarity:98/243 - (40%) Gaps:63/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 WGACEVKLNGSVAKL-------------DKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDLEQ- 113
            |..| ..:.||||.|             .|...:.:||:::|:.....::|.||   :|::||| 
Zfish    52 WRWC-AGIAGSVAALMLLLLIITVSVNHVKFNRKFSATEVRIQNLTQIILNVIS---RTQELEQF 112

  Fly   114 ------KLKDIEGNQ----TALSNQLKDGQKRTENQLTAIQKTLSDIE---RKLVLQRYQQI--- 162
                  .:..:|.:|    |:::|.|:..|        |:...:|:::   .|:.....|::   
Zfish   113 GHKINADVSSLEFDQRMTETSMNNLLESAQ--------ALHDKVSELKCHIDKMRNNNTQELCCP 169

  Fly   163 -------GSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLA 220
                   .:.||:....:  :|.:|...|......|....:..|.:.:|.:.....||||:.| .
Zfish   170 DQWSLFSSNCYFFSTDGM--SWDSARDECERKRAKLLILTSKLEKSFVVSKTKPLFYWLGLTD-G 231

  Fly   221 KQGEFISL-ASGKRATYFKWRKNEPKYNNPTQH-------CAYVFGHE 260
            :.||:..| .:.......:||..:|  :|...|       ||: |.|:
Zfish   232 RTGEWEWLDETPYEMVRSEWRPGQP--DNWKAHGLGGGEDCAH-FHHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 25/105 (24%)
asgrl2XP_005170656.1 zf-C4H2 <108..>165 CDD:313386 12/64 (19%)
CLECT_DC-SIGN_like 168..293 CDD:153060 25/115 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.