DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and LOC100363064

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_038945816.1 Gene:LOC100363064 / 100363064 RGDID:2324825 Length:285 Species:Rattus norvegicus


Alignment Length:266 Identity:49/266 - (18%)
Similarity:98/266 - (36%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QPVIDHLSKEQ-----QDWGACEVKLNGSVAKLDKIEDQLTATQ---IQIEAQQAFL-------- 98
            :|.:..|:..:     :|.|..|....|.:.....::..||...   :.:.:...||        
  Rat    25 KPELHQLNNHEEEVTLEDQGFAENDPEGLICSSKSLQGHLTRAPWLLLLLISLGLFLLMLAILVQ 89

  Fly    99 VNNISKAIKTEDLEQKLKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLV-------- 155
            |:.|....:.:..:||.....|.......|...|.::.: |:..||:.|:.....|.        
  Rat    90 VSRICANPQGQTQDQKGSSSLGKVAVPQEQTHTGLEQIQ-QIQQIQQQLTQFNASLAGLCRPCPW 153

  Fly   156 -LQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEE------YNAIVGQLNKANYW 213
             .:.:|  ||.|.:  .....:|..:...|.::|.||....:..|      :|....|.:    |
  Rat   154 DWEFFQ--GSCYLF--SRTLASWGASASSCKDLGAHLVIINSVAEQRFMKYWNVRKNQRS----W 210

  Fly   214 LGVNDLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCAYVF---GHENIMIVLSCTTDVMHF 275
            :|::|..::|.: .........:..|::.||. |:..:.|..:|   .::|     :||.. ..:
  Rat   211 IGLSDHLREGSW-QWVDHSPLKFSFWKEGEPN-NDGDEDCVELFMDEWNDN-----TCTQQ-NFW 267

  Fly   276 ICQSDS 281
            :|:..|
  Rat   268 VCEQPS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 23/122 (19%)
LOC100363064XP_038945816.1 CLECT_DC-SIGN_like 151..270 CDD:153060 25/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.