DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and illr2

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001121843.1 Gene:illr2 / 100147856 ZFINID:ZDB-GENE-050311-3 Length:253 Species:Danio rerio


Alignment Length:187 Identity:37/187 - (19%)
Similarity:71/187 - (37%) Gaps:34/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRT 179
            :.|.|.|.|....||.....:.:..|..:.:........|....:...|.:.:|.. .:::||..
Zfish    74 VSDQEHNATDYKEQLDVLHIQHQEMLQKLNRLNESSGCALCAVHWTHSGGKCYYFS-TVKMNWTQ 137

  Fly   180 AEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLAS---GKRATYF---- 237
            :...|:..||||....:..|.:.:..::: ..:|:|:||:..:|.::.:.:   .|...::    
Zfish   138 SRDHCVTKGGHLVIITSKAEQDFLASKIS-VTHWIGLNDMHTEGRWVWVDNQPLNKSVEFWMKRV 201

  Fly   238 -------KWRKNEPKYNNPTQHCAYVFGHENIMIVLSCT--------TDVMHFICQS 279
                   .|.||.|    ..:.|| ..||.     |..|        |....|:|::
Zfish   202 NGNNEPDNWTKNHP----GGEDCA-CLGHS-----LGATEFWNDDLCTATKRFVCEA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 27/135 (20%)
illr2NP_001121843.1 CLECT_DC-SIGN_like 114..247 CDD:153060 28/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.