DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and si:dkey-61f9.1

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_017210940.1 Gene:si:dkey-61f9.1 / 100034385 ZFINID:ZDB-GENE-041210-13 Length:364 Species:Danio rerio


Alignment Length:336 Identity:76/336 - (22%)
Similarity:110/336 - (32%) Gaps:113/336 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSSTRIILCAFLLLYPYGSLIEAQEGR-RYVCLLSDPPNQCSEYCVSALQPVIDHLSKEQQDWG 64
            ||....::||||    |    ..|.||| |...::....|.     .||.|.:            
Zfish     2 MFLLVPLLLCAF----P----PSAAEGRLRQFYIMKQRSNN-----TSAAQSL------------ 41

  Fly    65 ACEVKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDLEQ----------KLKDIE 119
             |.|.....|.    |.||    |..|:.||  |:|:.|       .:|          .||...
Zfish    42 -CRVNYTDLVT----IYDQ----QDNIKLQQ--LLNSSS-------FQQGWIGAYRGNYSLKWSN 88

  Fly   120 GNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQR-----YQQIGS-----RYFYIEHNLQ 174
            |:....|........:|.   .|......|.|..|..:.     |:|.|.     .|..|..|  
Zfish    89 GDDVTYSRYSPSYSDQTR---CAALNANGDWESILCNETKHFMCYEQDGDGGTTYNYLLIPQN-- 148

  Fly   175 VNWRTAEQRCIEMGGHLAAFQNAEEYNAIV---GQLNKANYWLG-VND----------------- 218
            .||..|:..|.|....|.:.:|.|| |.:|   |..:...:|:| :||                 
Zfish   149 KNWSDAQLYCRENHTDLVSIRNEEE-NTLVKNNGTQSNTAFWIGLLNDNVNWRDGGPSAYRNWFQ 212

  Fly   219 ---LAKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCAYVFGH--------ENIMIVLSCTTDV 272
               .::...|:.|..|      :|.:.:...|.|.  |...|.|        |:.|..  |::..
Zfish   213 EFEQSRPNAFMRLTDG------RWTRADINNNYPL--CYKSFIHVSPAEMSWEDAMNY--CSSQF 267

  Fly   273 MHFIC-QSDSD 282
            ...:| :|::|
Zfish   268 SGALCLESEND 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 32/151 (21%)
si:dkey-61f9.1XP_017210940.1 CLECT 23..130 CDD:295302 28/144 (19%)
CLECT 140..244 CDD:295302 26/114 (23%)
CLECT 242..363 CDD:153057 9/39 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.