DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and AT5G63690

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001318871.1 Gene:AT5G63690 / 836489 AraportID:AT5G63690 Length:139 Species:Arabidopsis thaliana


Alignment Length:132 Identity:43/132 - (32%)
Similarity:64/132 - (48%) Gaps:24/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKDIKPGLK-NINVIFIVLEVGVATVTKENREVRNFK------VGDPTACINVSIWDEPGKLIAP 66
            :|||.|..: ||:..||:|:       |......|.|      ..|.||.:::.:|.:.......
plant     5 LKDIVPAAQNNIDTRFIILD-------KAKSSAANGKNYCIALAADETAAVHIQLWGDECDAFEA 62

  Fly    67 GDIVRLTKGYASIWRHC-LTLYSGKNGEVFKIGEYCMVFNESVNMSE---------PKRAEQQAV 121
            ||||:||.|..|..|:. |.|.:||.|::.|:||:.:.|.|:.|:||         |||..|..|
plant    63 GDIVKLTNGIFSYVRNSGLILRAGKRGKMEKMGEFTVAFVETPNISEIQWIPDPENPKRYIQSGV 127

  Fly   122 AN 123
            .:
plant   128 VS 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 24/83 (29%)
AT5G63690NP_001318871.1 RPA_2b-aaRSs_OBF_like <39..122 CDD:415809 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4035
eggNOG 1 0.900 - - E1_KOG3416
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2585
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512483at2759
OrthoFinder 1 1.000 - - FOG0002617
OrthoInspector 1 1.000 - - oto3004
orthoMCL 1 0.900 - - OOG6_102951
Panther 1 1.100 - - LDO PTHR13356
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.