DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and NABP2

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_005269204.1 Gene:NABP2 / 79035 HGNCID:28412 Length:227 Species:Homo sapiens


Alignment Length:200 Identity:91/200 - (45%)
Similarity:119/200 - (59%) Gaps:23/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEPGKLIAPGDIVRLT 73
            :|||||||||:|:||||||.|..|.||:..|||..||.|.|..||:|:||:.|.||.||||:|||
Human    23 VKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLT 87

  Fly    74 KGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEP------KRAEQQAV---ANP----- 124
            |||||:::.|||||:|:.|::.||||:|||::|..|.|||      ::|..:||   :||     
Human    88 KGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQP 152

  Fly   125 -----AATPAGLPAGGGAPGLPAKGGATGIPQPAVAAAPGAPATQSAVTTAPAAAPAIAPQTTTK 184
                 ||:||.....|.  ||.|..|..|.|.|  ...|..|.:.....:.|...||..|..::.
Human   153 TTGPSAASPASENQNGN--GLSAPPGPGGGPHP--PHTPSHPPSTRITRSQPNHTPAGPPGPSSN 213

  Fly   185 PGTRG 189
            |.:.|
Human   214 PVSNG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 45/76 (59%)
NABP2XP_005269204.1 SoSSB_OBF 34..111 CDD:239937 45/76 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4268
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512483at2759
OrthoFinder 1 1.000 - - FOG0002617
OrthoInspector 1 1.000 - - otm40837
orthoMCL 1 0.900 - - OOG6_102951
Panther 1 1.100 - - LDO PTHR13356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3672
SonicParanoid 1 1.000 - - X1973
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.