DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and NABP1

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001026886.1 Gene:NABP1 / 64859 HGNCID:26232 Length:204 Species:Homo sapiens


Alignment Length:190 Identity:83/190 - (43%)
Similarity:110/190 - (57%) Gaps:26/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NVECIPIKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEPGKLIAPG 67
            |...|.|:||||||||:||:|||||:|..|.||:..|||:.||.|.|..|.:|:|||.|.||.||
Human     5 NDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPG 69

  Fly    68 DIVRLTKGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEP---------KRAEQQAVAN 123
            ||:|||:||||:|:.|||||:|:.||:.||||:|||::|..|.|||         |.|:.:...|
Human    70 DIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNN 134

  Fly   124 PAATPAGL----PAGGGAPGLP----------AKGGATGIPQPAVAAAPGAPATQSAVTT 169
            ...:..|.    |.|.|....|          .:....|:..|.:   .|..:.|:.:||
Human   135 SMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQL---QGTASNQTVMTT 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 46/76 (61%)
NABP1NP_001026886.1 SoSSB_OBF 22..99 CDD:239937 46/76 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..187 13/75 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160413
Domainoid 1 1.000 149 1.000 Domainoid score I4464
eggNOG 1 0.900 - - E1_KOG3416
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4268
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512483at2759
OrthoFinder 1 1.000 - - FOG0002617
OrthoInspector 1 1.000 - - otm40837
orthoMCL 1 0.900 - - OOG6_102951
Panther 1 1.100 - - O PTHR13356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3672
SonicParanoid 1 1.000 - - X1973
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.