DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and nabp1b

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001025423.1 Gene:nabp1b / 570609 ZFINID:ZDB-GENE-050913-74 Length:216 Species:Danio rerio


Alignment Length:191 Identity:79/191 - (41%)
Similarity:103/191 - (53%) Gaps:29/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEPGKLIAPGDIVRLT 73
            |||:|.||||||::|||||.|..:.||:..|||:.||.|.|..|.:|:|||.|.||..|||:|||
Zfish    12 IKDLKAGLKNINLVFIVLETGRVSKTKDGHEVRSCKVADRTGSITISVWDEVGSLIQTGDIIRLT 76

  Fly    74 KGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEPKRAEQQAVANPAATPAGLPAGGGAP 138
            :||||:::.|||||.|:.|::.||||:||:|:|:.|.|||.......:.....|.....|.|..|
Zfish    77 RGYASLFKGCLTLYIGRTGDLQKIGEFCMIFSETPNFSEPNPEVLAKINQINNTHVKTEAHGSNP 141

  Fly   139 GLPAKGGATGIPQPAVAAAPGAPATQSAVTTAPAAAPAIAPQT--TTKPGTR-GGRGGGGR 196
            .|                          |...|.|.|.:..|.  :...|:| |..|.|||
Zfish   142 SL--------------------------VNPVPPAVPTVNGQAVYSFSAGSREGSFGSGGR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 41/76 (54%)
nabp1bNP_001025423.1 RPA_2b-aaRSs_OBF_like 12..119 CDD:299125 62/106 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596787
Domainoid 1 1.000 151 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_KOG3416
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134412
Inparanoid 1 1.050 151 1.000 Inparanoid score I4329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512483at2759
OrthoFinder 1 1.000 - - FOG0002617
OrthoInspector 1 1.000 - - otm25803
orthoMCL 1 0.900 - - OOG6_102951
Panther 1 1.100 - - O PTHR13356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1973
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.760

Return to query results.
Submit another query.