DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and nabp2

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001007990.1 Gene:nabp2 / 493352 XenbaseID:XB-GENE-985188 Length:203 Species:Xenopus tropicalis


Alignment Length:188 Identity:81/188 - (43%)
Similarity:110/188 - (58%) Gaps:33/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEPGKLIAPGDIVRLT 73
            :||:||||||::|:|||||.|..|.||:..|||..||.|.|..||:|:||:.|..|.||||:|||
 Frog     7 VKDVKPGLKNLSVLFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDLGNFIQPGDIIRLT 71

  Fly    74 KGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEP-----------KRAEQQA------- 120
            |||||:::.|||||:|:.|::.||||:|||::|..|.|||           |:|:.::       
 Frog    72 KGYASLFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYIAQQSQNKQAQAESGTGTNSH 136

  Fly   121 -VANPAATPAGLPAGGG------------APGLPAKGGATGIPQPAVAAAPGAPATQS 165
             .::||...:.|..|.|            ||.....|..|. .||. .:.||||.:.|
 Frog   137 NSSSPAPPASDLENGNGSNSSGPPTHQSTAPTHSTSGRITR-SQPN-HSIPGAPNSVS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 43/76 (57%)
nabp2NP_001007990.1 SoSSB_OBF 18..95 CDD:239937 43/76 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..203 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4352
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512483at2759
OrthoFinder 1 1.000 - - FOG0002617
OrthoInspector 1 1.000 - - oto103049
Panther 1 1.100 - - LDO PTHR13356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3672
SonicParanoid 1 1.000 - - X1973
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.