DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and Nabp1

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001014238.1 Gene:Nabp1 / 363227 RGDID:1306658 Length:198 Species:Rattus norvegicus


Alignment Length:185 Identity:85/185 - (45%)
Similarity:110/185 - (59%) Gaps:16/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYNVECIP--IKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEPGKL 63
            |:.|...|  |||||.||||:||:|||||:|..|.||:..|||:.||.|.|..|.:|:|||.|.|
  Rat     1 MHGVNDPPLFIKDIKAGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADRTGSITISVWDEIGGL 65

  Fly    64 IAPGDIVRLTKGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEPK---RAEQQAVANP- 124
            |..|||:|||:||||:|:.|||||:|:.||:.||||:|||::|..|.|||.   |.:|..|... 
  Rat    66 IQTGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNRVVQNE 130

  Fly   125 ----------AATPAGLPAGGGAPGLPAKGGATGIPQPAVAAAPGAPATQSAVTT 169
                      .....|:..|..:.|.|.:.|.:..|.|.....||.|:.|:..||
  Rat   131 QKDKMNTSIFGTVGNGVQTGPESRGYPLQYGRSNGPGPISPQLPGEPSNQTVRTT 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 45/76 (59%)
Nabp1NP_001014238.1 SoSSB_OBF 22..99 CDD:239937 45/76 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..198 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354476
Domainoid 1 1.000 154 1.000 Domainoid score I4167
eggNOG 1 0.900 - - E1_KOG3416
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4118
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512483at2759
OrthoFinder 1 1.000 - - FOG0002617
OrthoInspector 1 1.000 - - otm44981
orthoMCL 1 0.900 - - OOG6_102951
Panther 1 1.100 - - O PTHR13356
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1973
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.