DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and Nabp2

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001030111.2 Gene:Nabp2 / 362813 RGDID:1308158 Length:243 Species:Rattus norvegicus


Alignment Length:200 Identity:89/200 - (44%)
Similarity:120/200 - (60%) Gaps:23/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEPGKLIAPGDIVRLT 73
            :|||||||||:|:||||||.|..|.||:..|||..||.|.|..||:|:||:.|.||.||||:|||
  Rat    39 VKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLT 103

  Fly    74 KGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEP------KRAEQQAVAN--------- 123
            |||||:::.|||||:|:.|::.||||:|||::|..|.|||      ::|..::|.|         
  Rat   104 KGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYNTQQASNKSVQNDSSPTAPQA 168

  Fly   124 ----PAATPAGLPAGGGAPGLPAKGGATGIPQPAVAAAPGAPATQSAVTTAPAAAPAIAPQTTTK 184
                |||:||.....|.  ||..:.|..|.|.|  :.||..|.:.....:.|...|:..|..::.
  Rat   169 TTGPPAASPASESQNGN--GLSTQPGPVGGPHP--SHAPSHPPSTRITRSQPNHTPSGPPGPSSS 229

  Fly   185 PGTRG 189
            |.:.|
  Rat   230 PVSNG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 45/76 (59%)
Nabp2NP_001030111.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3416
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4118
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512483at2759
OrthoFinder 1 1.000 - - FOG0002617
OrthoInspector 1 1.000 - - otm44981
orthoMCL 1 0.900 - - OOG6_102951
Panther 1 1.100 - - LDO PTHR13356
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1973
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.