DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and C06G3.8

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_501089.1 Gene:C06G3.8 / 177470 WormBaseID:WBGene00015554 Length:137 Species:Caenorhabditis elegans


Alignment Length:106 Identity:39/106 - (36%)
Similarity:64/106 - (60%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IPIKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWD-EPGKLIAPGDIV 70
            ||:..::|.:.:.:|..|||:.|:...| :...:.:.||.|.:..||.||.: |..:...||||:
 Worm     5 IPLHQLQPNMNSFSVTVIVLDPGIHRRT-QTGTIISMKVADASGSINASIMNPEFNETFKPGDIL 68

  Fly    71 RLTKGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMS 111
            :....|.||::..|||..||:||..|:||:.|||:|:.::|
 Worm    69 KFRGAYTSIYQGGLTLSVGKSGECKKVGEFMMVFSETPDIS 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 28/77 (36%)
C06G3.8NP_501089.1 SoSSB_OBF 18..95 CDD:239937 28/77 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I6370
eggNOG 1 0.900 - - E1_KOG3416
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I3929
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512483at2759
OrthoFinder 1 1.000 - - FOG0002617
OrthoInspector 1 1.000 - - oto20033
orthoMCL 1 0.900 - - OOG6_102951
Panther 1 1.100 - - LDO PTHR13356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3672
SonicParanoid 1 1.000 - - X1973
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.