DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and si:dkey-249d8.1

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_005172178.1 Gene:si:dkey-249d8.1 / 101883672 ZFINID:ZDB-GENE-110411-157 Length:385 Species:Danio rerio


Alignment Length:126 Identity:33/126 - (26%)
Similarity:46/126 - (36%) Gaps:31/126 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KDIKPGLKNINVIFIVLEVGVATVTKENREV--------RNFKVGDPTACINVSIWDEPGKLIAP 66
            :|.||...||||..|      ..|.|.|:.|        ..:.|.|.|..|::::|.|..  |..
Zfish   122 RDTKPNKVNINVKII------QEVCKGNKVVWDGSYLPKTEYIVADTTGSISLTVWREHN--ITV 178

  Fly    67 GDIVRLTKGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEPKRAEQQAVANPAAT 127
            ||...:|...|..:|...||.:.:|.::..|               |.|....|...|..|
Zfish   179 GDWYTITNVSAKEFRGKATLSTTRNTQILNI---------------PSRGTAAAAEVPTQT 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 22/84 (26%)
si:dkey-249d8.1XP_005172178.1 PRK07218 96..>210 CDD:333225 28/110 (25%)
RPA_2b-aaRSs_OBF_like <158..206 CDD:324543 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.