DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5181 and nabp2

DIOPT Version :9

Sequence 1:NP_609115.1 Gene:CG5181 / 34018 FlyBaseID:FBgn0031909 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_005172861.1 Gene:nabp2 / 101882738 ZFINID:ZDB-GENE-160114-62 Length:196 Species:Danio rerio


Alignment Length:205 Identity:90/205 - (43%)
Similarity:112/205 - (54%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEPGKLIAPGDIVRLT 73
            :|||||||||:||||||||.|..|.||:..|||..||.|.|..|::|:|||.|.||..|||:|||
Zfish     7 VKDIKPGLKNLNVIFIVLETGRVTKTKDGHEVRTCKVADKTGSISISVWDEVGGLIQAGDIIRLT 71

  Fly    74 KGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEPK----------RAEQQAVANP---A 125
            |||||:::.|||||:|:.||:.||||:|||::|..|.|||.          ....|:..|.   |
Zfish    72 KGYASVFKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPEYLTQTNKTGLNDQSNMNSSTGA 136

  Fly   126 ATPAGLPAGGGAPGLPAKGGATGIPQPAVAAAPGAPATQSAVTTAPAAAPAIAPQTTTKPGTRGG 190
            .|....|.|.|. ...|.|.::. ||.:..|..|   ..:..|.:|||.           ||...
Zfish   137 TTGTDTPNGNGV-NSQASGNSSN-PQSSGRANSG---NGNRSTPSPAAG-----------GTSVS 185

  Fly   191 RGGGGRGGLK 200
            .|...|..||
Zfish   186 NGKETRRTLK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5181NP_609115.1 SoSSB_OBF 20..97 CDD:239937 46/76 (61%)
nabp2XP_005172861.1 RPA_2b-aaRSs_OBF_like 1..114 CDD:299125 67/106 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 151 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_KOG3416
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512483at2759
OrthoFinder 1 1.000 - - FOG0002617
OrthoInspector 1 1.000 - - otm25803
orthoMCL 1 0.900 - - OOG6_102951
Panther 1 1.100 - - LDO PTHR13356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3672
SonicParanoid 1 1.000 - - X1973
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.