DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5171 and TPS2

DIOPT Version :10

Sequence 1:NP_001188709.1 Gene:CG5171 / 34016 FlyBaseID:FBgn0031907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_173142.2 Gene:TPS2 / 838269 AraportID:AT1G16980 Length:822 Species:Arabidopsis thaliana


Alignment Length:230 Identity:45/230 - (19%)
Similarity:80/230 - (34%) Gaps:78/230 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALLLN------ATRSYREIVKMP-EKQVAPVISNLE------------DFANNLPGYLISESPV- 53
            ||::|      .:.:.:|.:.|| |::.....||.:            ||.:.|.| :|.||.: 
plant   424 ALIVNPWDVTEVSSAIKEALNMPAEERETRHRSNFQYVCTHSAEKWGLDFMSELNG-IIPESEMQ 487

  Fly    54 -----------------------AVLLDYDGTLAPIADNPAK---TKMPVELEAILHKIAKHPKV 92
                                   .::|.:.||||...::..|   .|:..||:..|..:...||.
plant   488 MRKIPLQLPEQDVIQQYSQSNNRLIILGFFGTLAEPMNSGTKEMDLKLNPELKGTLKALCNDPKT 552

  Fly    93 FLAVISGRGLKDVQKQVNIDGITYAGNHGL-----------------EIEYPDGSRHDYELPTEI 140
            .:.|:|..|...:.|......|..|..:|:                 .:::.||.::.::..|: 
plant   553 TVVVLSRSGKNILNKNFGESNIWLAAENGMFEKQTTGEWVTNMPQNVNLDWVDGVKNVFKYFTD- 616

  Fly   141 QKNYTQMVRELKEKVEKNGAWVEDKKVSLTYHYRD 175
                 :..|...|..|.:..|        .|.|.|
plant   617 -----RTPRSYFEASETSLVW--------NYEYAD 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5171NP_001188709.1 HAD_TPP 54..282 CDD:319767 29/142 (20%)
TPS2NP_173142.2 PLN03063 2..786 CDD:215555 45/230 (20%)

Return to query results.
Submit another query.