DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5171 and AT4G27565

DIOPT Version :10

Sequence 1:NP_001188709.1 Gene:CG5171 / 34016 FlyBaseID:FBgn0031907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001328875.1 Gene:AT4G27565 / 28720185 AraportID:AT4G27565 Length:122 Species:Arabidopsis thaliana


Alignment Length:50 Identity:12/50 - (24%)
Similarity:26/50 - (52%) Gaps:4/50 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PAKTKMPV---ELEAILHKIAKHPKVFLAVISG-RGLKDVQKQVNIDGIT 115
            |:|..|..   ::|..||:.|...:..:|.:.. .|:|::.:.::|..|:
plant     3 PSKNLMRYQANQMEHSLHRKALRNEFIVAFMQPFGGMKELHQNLDITAIS 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5171NP_001188709.1 HAD_TPP 54..282 CDD:319767 12/49 (24%)
AT4G27565NP_001328875.1 PLN03063 <60..91 CDD:215555
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.