DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and rit1

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001122253.1 Gene:rit1 / 793942 ZFINID:ZDB-GENE-070912-329 Length:211 Species:Danio rerio


Alignment Length:208 Identity:72/208 - (34%)
Similarity:107/208 - (51%) Gaps:34/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGVS 88
            |:::||:.||||:|::::||:.||..::||.:|..|..|..:|.|....||||..||.:..  ..
Zfish    15 KLVMLGEGGVGKSAIIMQFISHRFPEDHDPTIEDAYKTQIRIDDEPANLDILDTAGQAEFT--AM 77

  Fly    89 LESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKTDQP 153
            .:..:|..:.||:.|||||:.||.|....|.|| |..||          .:|.||:|||||:|..
Zfish    78 RDQYMRAGEGFIISYSITDRRSFQEARHFKQLI-YRVRR----------TVDTPVVLVGNKSDLV 131

  Fly   154 GDRMVSLEEGQRRFRELSCSCFH-EISVRESVDQV------------QNVFRDVFR-------FW 198
            ..|.||:|||::..||..|..|. ..:.|..:|:|            ..:.||..|       ||
Zfish   132 HLRQVSVEEGKQLAREFQCPFFETSAAFRYYIDEVFAALVRQIRQHEAEMVRDSERKTRRSHSFW 196

  Fly   199 -RVFSKFPKLKRS 210
             |:.:.|.:.::|
Zfish   197 SRLKAPFHRKQQS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 66/184 (36%)
RERG_RasL11_like 24..200 CDD:206713 69/196 (35%)
rit1NP_001122253.1 P-loop_NTPase 12..180 CDD:304359 64/177 (36%)
small_GTPase 12..177 CDD:197466 64/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.