DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Rasl12

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001028330.2 Gene:Rasl12 / 70784 MGIID:1918034 Length:266 Species:Mus musculus


Alignment Length:221 Identity:71/221 - (32%)
Similarity:107/221 - (48%) Gaps:23/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGV 87
            :.:.:||:.|.||:|:.|:|:|:|||.|||||||..|:.:.|:|.:.:...::|..    :||..
Mouse    21 VNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPVHLRVMDTA----DLDTP 81

  Fly    88 -SLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKTD 151
             :.|..:.||.||:::||:..:.||:..|....|         |...:||.....|.:|:|||.|
Mouse    82 RNCERYLNWAHAFLVVYSVDSRASFEGSSSYLEL---------LALHAKETQRGYPALLLGNKLD 137

  Fly   152 QPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFR-FWRVFSKFPKLKR----ST 211
            ....|.|:..||........| .|.|:|.....:.||:||.:..| ..|...|.| |.|    |.
Mouse   138 MAQYRQVTKAEGAALAGRFGC-LFFEVSACLDFEHVQHVFHEAVREVRRELDKSP-LARPLFISE 200

  Fly   212 SDVANTDGILTPDSG--SCSFYDASS 235
            ....:....||...|  ||:|...|:
Mouse   201 EKTLSHQTPLTARHGLASCTFNTLST 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 57/173 (33%)
RERG_RasL11_like 24..200 CDD:206713 58/177 (33%)
Rasl12NP_001028330.2 RERG_RasL11_like 22..185 CDD:206713 58/176 (33%)
RAS 23..185 CDD:214541 58/175 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.