DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and RASL11B

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_076429.1 Gene:RASL11B / 65997 HGNCID:23804 Length:248 Species:Homo sapiens


Alignment Length:220 Identity:71/220 - (32%)
Similarity:115/220 - (52%) Gaps:40/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QKTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQEL 84
            ::.:|:.|:|.|||||||:||||:|:||||:|:.|...:||.|..::.|.:..       |:|:.
Human    31 RRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGETLAL-------QVQDT 88

  Fly    85 DGVSLESN-----------IRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYA 138
            .|:.:..|           ||||||.::::||||..|::..|:|    :.:.::..||:.     
Human    89 PGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQL----HQHVQQLHLGTR----- 144

  Fly   139 LDIPVILVGNKTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFRFWRVFSK 203
              :||::|.||.|....:.|..:.|.:....|.|| |:|:||.|:       :.||:..:.|..|
Human   145 --LPVVVVANKADLLHIKQVDPQLGLQLASMLGCS-FYEVSVSEN-------YNDVYSAFHVLCK 199

  Fly   204 FPKLKR---STSDVANTDGILTPDS 225
            ....|:   ||.:...|..|..|.|
Human   200 EVSHKQQPSSTPEKRRTSLIPRPKS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 62/185 (34%)
RERG_RasL11_like 24..200 CDD:206713 62/186 (33%)
RASL11BNP_076429.1 Small GTPase-like 29..246 71/220 (32%)
RERG_RasL11_like 35..203 CDD:206713 64/193 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..226 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2554
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.