DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and RIT1

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001243750.1 Gene:RIT1 / 6016 HGNCID:10023 Length:236 Species:Homo sapiens


Alignment Length:210 Identity:73/210 - (34%)
Similarity:101/210 - (48%) Gaps:34/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGVS 88
            |:::||..||||:||.::||:.||..::||.:|..|..:..:|.|....||||..||.:..  ..
Human    40 KLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFT--AM 102

  Fly    89 LESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKTDQP 153
            .:..:|..:.||:.|||||:.||.|....|.|| |..||..          |.||:|||||:|..
Human   103 RDQYMRAGEGFIICYSITDRRSFHEVREFKQLI-YRVRRTD----------DTPVVLVGNKSDLK 156

  Fly   154 GDRMVSLEEGQRRFRELSCSCFH-EISVRESVDQV-QNVFRDVFR------------------FW 198
            ..|.|:.|||....||.||..|. ..:.|..:|.| ..:.|::.|                  .|
Human   157 QLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVW 221

  Fly   199 -RVFSKFPKLKRSTS 212
             |:.|.|.|.|.|.:
Human   222 KRLKSPFRKKKDSVT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 65/173 (38%)
RERG_RasL11_like 24..200 CDD:206713 67/196 (34%)
RIT1NP_001243750.1 Rit_Rin_Ric 37..208 CDD:206712 66/180 (37%)
small_GTPase 37..202 CDD:197466 65/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.