DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and RIT2

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_002921.1 Gene:RIT2 / 6014 HGNCID:10017 Length:217 Species:Homo sapiens


Alignment Length:205 Identity:70/205 - (34%)
Similarity:102/205 - (49%) Gaps:22/205 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLHTNKQKTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDAT 78
            |..:...:..||::||..||||:||.::||:.:|...:||.:|..|..|..:|.|....||||..
Human    12 GSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTA 76

  Fly    79 GQLQELDGVSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPV 143
            ||.:..  ...|..:|..:.||:.||:||:.||.|.::.|.|| :..|          :..:||:
Human    77 GQAEFT--AMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELI-FQVR----------HTYEIPL 128

  Fly   144 ILVGNKTDQPGDRMVSLEEGQRRFRELSCSCFH-EISVRESVDQVQNVFRDVFRFWRVFSKFP-- 205
            :|||||.|....|.||.|||....:|.:|..|. ..::|..:|   :.|..:.|..|.....|  
Human   129 VLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCID---DAFHGLVREIRKKESMPSL 190

  Fly   206 ---KLKRSTS 212
               ||||..|
Human   191 MEKKLKRKDS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 61/175 (35%)
RERG_RasL11_like 24..200 CDD:206713 62/176 (35%)
RIT2NP_002921.1 Rit_Rin_Ric 19..190 CDD:206712 64/186 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.