DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Rgk3

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster


Alignment Length:247 Identity:70/247 - (28%)
Similarity:104/247 - (42%) Gaps:72/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMVLGQSGVGKTAMVVRFITRRFIGEYD-PNLEKIYTCQTTLDKEQIQFDILDAT-GQLQELDG 86
            :|.:||.:||||.|::.:|.|...|..|| |..:         |.||....||:.| .:|:.|.|
  Fly   236 RVEMLGSAGVGKQALLSQFRTSDCINAYDGPECD---------DAEQNVSIILNGTESELKFLTG 291

  Fly    87 -VSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDI----PVILV 146
             ...:..:..||||:::||..||.||   :|.|.::            |:...:|:    |.|||
  Fly   292 NPESKDELEQADAFLVVYSCIDKESF---TRAKQIL------------SRLQDMDLLRHRPTILV 341

  Fly   147 GNKTDQPGDRMVSLEEGQ-------RRFRELSCSCFHE---------ISVRESVDQVQ------- 188
            .||.|....|.||.::|:       .:|.|:|....|.         ..:|...||||       
  Fly   342 ANKIDLARSRAVSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKK 406

  Fly   189 NVFRDVFRFWRVFSKFPKLKRSTS-DVANTDGILT----PDSGSCSFYDASS 235
            :..:|..:|          |.:|: :...||..||    .|.|.   .||:|
  Fly   407 SKDKDKNKF----------KENTNIETVETDNCLTDLKADDGGP---RDANS 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 58/201 (29%)
RERG_RasL11_like 24..200 CDD:206713 59/205 (29%)
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 53/183 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.