DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and rasl11a

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001017840.2 Gene:rasl11a / 550538 ZFINID:ZDB-GENE-050417-384 Length:253 Species:Danio rerio


Alignment Length:177 Identity:67/177 - (37%)
Similarity:97/177 - (54%) Gaps:18/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILD--ATGQLQE 83
            |.:|::|||.|.|||||::|||:|:||||:|:.|...:|:.:..||.||:...:.|  ......:
Zfish    35 KNVKIVVLGASNVGKTALIVRFLTKRFIGDYEANTGALYSRKINLDGEQVSLQVQDTPCVSLQDD 99

  Fly    84 LDGV----SLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVI 144
            .||:    .:..:|.|||.::|::||||..|:.....|     |...||...|.      :||||
Zfish   100 ADGLYCQEQINRSIYWADGYVLVFSITDLNSYRTIQPL-----YQHVRRIHPSG------NIPVI 153

  Fly   145 LVGNKTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVF 191
            :||||:|....|.||..||:....||. ..:.|.|.||:.:.||..|
Zfish   154 IVGNKSDLLRARQVSDPEGKALADELG-GLYFEASARENHESVQAAF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 67/177 (38%)
RERG_RasL11_like 24..200 CDD:206713 66/174 (38%)
rasl11aNP_001017840.2 RERG_RasL11_like 38..208 CDD:206713 66/174 (38%)
Ras 38..206 CDD:278499 66/174 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..233
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.