DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Rergl

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001178908.1 Gene:Rergl / 500356 RGDID:1560090 Length:204 Species:Rattus norvegicus


Alignment Length:181 Identity:63/181 - (34%)
Similarity:100/181 - (55%) Gaps:12/181 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGV 87
            :|:.|||..|.||:|:.|||:|:||||||..|.|.||.....|:.:.:..:|.|...|.|:..| 
  Rat     4 VKLAVLGGRGTGKSALTVRFLTKRFIGEYASNFESIYNKHLCLEGKPLNLEIYDPCSQSQKAKG- 67

  Fly    88 SLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKTDQ 152
            ||.|::.|||.|:::|.|:::.||   :..|.|| |..|...:....:  .::..|:|||||.|.
  Rat    68 SLTSDLHWADGFVIVYDISNRPSF---AFAKALI-YRIREPPMTHCKR--VMEPAVVLVGNKQDL 126

  Fly   153 PGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVF----RDVFRFWR 199
            ...|.|..:|||:...:..|. |.|:|..|...:::.:|    :|:...::
  Rat   127 CHMREVGWDEGQKLATDYRCQ-FCELSAAEQSLEIEVMFLRLIKDILMIFK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 63/176 (36%)
RERG_RasL11_like 24..200 CDD:206713 63/180 (35%)
RerglNP_001178908.1 RERG_RasL11_like 5..171 CDD:206713 62/173 (36%)
small_GTPase 5..171 CDD:197466 62/173 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.