DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and CG8500

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster


Alignment Length:224 Identity:67/224 - (29%)
Similarity:106/224 - (47%) Gaps:29/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATG--QLQELDG 86
            :|:|.|..||||:::|:|||...|...|.|.:|..|....:.:|......|.|.||  |...:..
  Fly    20 RVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSHQFPAMQR 84

  Fly    87 VSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKTD 151
            :|:..    ..||||:||:..|.|.:|...:..||      ::|..|.   ..:|||:|||||.|
  Fly    85 LSISK----GHAFILVYSVCSKQSLEELRPIWALI------KELKGAD---IPNIPVMLVGNKCD 136

  Fly   152 QPGD-RMVSLEEGQRR-------FRELSCSCFHEISVRESVDQVQNVFRDVFRFWRVFSKFPKLK 208
            :..: |.||..|||.:       |.|.|....|  :|.|...::.|:.:......::.:|..|.:
  Fly   137 ETAELREVSQAEGQAQATTWSISFMETSAKTNH--NVTELFQELLNMEKTRTVSLQLDTKKQKKQ 199

  Fly   209 RSTSDVANTDGILTPDSGSCSFYDASSLG 237
            :......:|:|.: |::|...   ||:.|
  Fly   200 KKEKKSKDTNGSI-PENGDAG---ASASG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 58/181 (32%)
RERG_RasL11_like 24..200 CDD:206713 58/185 (31%)
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 58/177 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452999
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.