DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Ras85D

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster


Alignment Length:148 Identity:43/148 - (29%)
Similarity:78/148 - (52%) Gaps:18/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGVS 88
            |::|:|..||||:|:.::.|...|:.||||.:|..|..|..:|.|....||||..|| :|...:.
  Fly     5 KLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQ-EEYSAMR 68

  Fly    89 LESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKTDQP 153
             :..:|..:.|:|::::....||::..      .|.::.:::..|.     ::|::|||||.|  
  Fly    69 -DQYMRTGEGFLLVFAVNSAKSFEDIG------TYREQIKRVKDAE-----EVPMVLVGNKCD-- 119

  Fly   154 GDRMVSLEEGQRRFRELS 171
               :.|......:.||::
  Fly   120 ---LASWNVNNEQAREVA 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 43/148 (29%)
RERG_RasL11_like 24..200 CDD:206713 43/148 (29%)
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 43/148 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452998
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.