DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and RASL11A

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_996563.1 Gene:RASL11A / 387496 HGNCID:23802 Length:242 Species:Homo sapiens


Alignment Length:177 Identity:68/177 - (38%)
Similarity:102/177 - (57%) Gaps:17/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELD 85
            |.:|:.|||...|||:||:|||:|:||||:|:||..|:|:....::.:|:...|.|..|.:|..|
Human    26 KDIKLAVLGAGRVGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYVEGDQLSLQIQDTPGGVQIQD 90

  Fly    86 GV-----SLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVIL 145
            .:     ||...::||:.|:|:|||||   :|....::.|..:   .||:...||     .|||:
Human    91 SLPQVVDSLSKCVQWAEGFLLVYSITD---YDSYLSIRPLYQH---IRKVHPDSK-----APVII 144

  Fly   146 VGNKTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFR 192
            ||||.|....|.|..::|.:...||. |.|.|||..|:.:.|.:||:
Human   145 VGNKGDLLHARQVQTQDGIQLANELG-SLFLEISTSENYEDVCDVFQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 68/177 (38%)
RERG_RasL11_like 24..200 CDD:206713 67/174 (39%)
RASL11ANP_996563.1 Small GTPase-like 17..241 68/177 (38%)
RERG_RasL11_like 29..198 CDD:206713 67/174 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.