DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Ras64B

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster


Alignment Length:188 Identity:63/188 - (33%)
Similarity:97/188 - (51%) Gaps:25/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KQKTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQE 83
            :.:|.|::|:|..||||:|:.::||...|:.:|||.:|..||.|..:|....:.||||..|| :|
  Fly     2 QMQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQ-EE 65

  Fly    84 LDGVSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGN 148
            ...:. |..:|..:.|:|::::.|..||||..:.:..|...|.|.           :.|:::|||
  Fly    66 FSAMR-EQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRD-----------EFPMLMVGN 118

  Fly   149 KTDQPGDRMVSLEEGQRRFREL-----SCSCFHEISVRESVDQVQNVFRDVFRFWRVF 201
            |.|....:.|||||.|...|.|     .||.    .:|.:|||   .|.::.|..|.|
  Fly   119 KCDLKHQQQVSLEEAQNTSRNLMIPYIECSA----KLRVNVDQ---AFHELVRIVRKF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 60/179 (34%)
RERG_RasL11_like 24..200 CDD:206713 60/180 (33%)
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 61/182 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452994
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.